Protein Info for b2013 in Escherichia coli BW25113

Name: yeeE
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 72 to 100 (29 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF04143: Sulf_transp" amino acids 21 to 331 (311 residues), 396.5 bits, see alignment E=5.1e-123

Best Hits

Swiss-Prot: 100% identical to YEEE_ECOLI: UPF0394 inner membrane protein YeeE (yeeE) from Escherichia coli (strain K12)

KEGG orthology group: K07112, (no description) (inferred from 100% identity to eco:b2013)

MetaCyc: 100% identical to thiosulfate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-496

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33015 at UniProt or InterPro

Protein Sequence (352 amino acids)

>b2013 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MFSMILSGLICGALLGFVMQRGRFCLTGGFRDMYIVKNNRMFYALLIAISVQSVGVFALI
QAGLLTYEAGAFPWLGTVIGGYIFGLGIVLAGGCATGTWYRAGEGLIGSWIALFTYMVMS
AVMRSPHASGLNQTLQHYSTEHNSIAETFNLSVWPLVAVLLVITLWVVMKELKKPKLKVA
TLPPRRTGIAHILFEKRWHPFVTAVLIGLIALLAWPLSEATGRMFGLGITSPTANILQFL
VAGDMKYINWGVFLVLGIFVGSFIAAKASREFRVRAADAQTTLRSGLGGVLMGFGASIAG
GCSIGNGLVMTAMMTWQGWIGLVFMILGVWTASWLVYVRPQRKARLATAAAN