Protein Info for b2009 in Escherichia coli BW25113

Name: sbmC
Annotation: DNA gyrase inhibitor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF06445: GyrI-like" amino acids 1 to 152 (152 residues), 113.2 bits, see alignment E=1.4e-36 PF14526: Cass2" amino acids 4 to 152 (149 residues), 109.4 bits, see alignment E=1.9e-35

Best Hits

Swiss-Prot: 100% identical to SBMC_ECOLI: DNA gyrase inhibitor (sbmC) from Escherichia coli (strain K12)

KEGG orthology group: K07470, DNA gyrase inhibitor (inferred from 100% identity to eco:b2009)

Predicted SEED Role

"DNA gyrase inhibitory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33012 at UniProt or InterPro

Protein Sequence (157 amino acids)

>b2009 DNA gyrase inhibitor (NCBI) (Escherichia coli BW25113)
MNYEIKQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPA
EKLRCDTVVTVPGYFTLPENSEGVILTEITGGQYAVAVARVVGDDFAKPWYQFFNSLLQD
SAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPKHH