Protein Info for b2004 in Escherichia coli BW25113

Name: yeeU
Annotation: CP4-44 prophage; antitoxin of the YeeV-YeeU toxin-antitoxin system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF06154: CbeA_antitoxin" amino acids 18 to 117 (100 residues), 174.5 bits, see alignment E=3e-56

Best Hits

Swiss-Prot: 100% identical to CBEA_ECOLI: Cytoskeleton bundling-enhancing antitoxin CbeA (cbeA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2004)

Predicted SEED Role

"YeeU protein (antitoxin to YeeV)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76364 at UniProt or InterPro

Protein Sequence (122 amino acids)

>b2004 CP4-44 prophage; antitoxin of the YeeV-YeeU toxin-antitoxin system (NCBI) (Escherichia coli BW25113)
MSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAY
HLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEM
KN