Protein Info for b1985 in Escherichia coli BW25113

Name: yeeO
Annotation: predicted multidrug efflux system (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 352 to 377 (26 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 420 to 443 (24 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details PF01554: MatE" amino acids 48 to 208 (161 residues), 127.6 bits, see alignment E=1.9e-41 amino acids 278 to 439 (162 residues), 73.2 bits, see alignment E=1.1e-24 TIGR00797: MATE efflux family protein" amino acids 48 to 452 (405 residues), 233.7 bits, see alignment E=1.8e-73

Best Hits

Swiss-Prot: 100% identical to YEEO_ECOLI: Probable FMN/FAD exporter YeeO (yeeO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1985)

MetaCyc: 100% identical to FMN/FAD exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-272; TRANS-RXN0-595

Predicted SEED Role

"FIG01069516: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76352 at UniProt or InterPro

Protein Sequence (495 amino acids)

>b1985 predicted multidrug efflux system (RefSeq) (Escherichia coli BW25113)
MWFHFLQLRSALNISSALRQVVHGTRWHAKRKSYKVLFWREITPLAVPIFMENACVLLMG
VLSTFLVSWLGKDAMAGVGLADSFNMVIMAFFAAIDLGTTVVVAFSLGKRDRRRARVATR
QSLVIMTLFAVLLATLIHHFGEQIIDFVAGDATTEVKALALTYLELTVLSYPAAAITLIG
SGALRGAGNTKIPLLINGSLNILNIIISGILIYGLFSWPGLGFVGAGLGLTISRYIGAVA
ILWVLAIGFNPALRISLKSYFKPLNFSIIWEVMGIGIPASVESVLFTSGRLLTQMFVAGM
GTSVIAGNFIAFSIAALINLPGSALGSASTIITGRRLGVGQIAQAEIQLRHVFWLSTLGL
TAIAWLTAPFAGVMASFYTQDPQVKHVVVILIWLNALFMPIWSASWVLPAGFKGARDARY
AMWVSMLSMWGCRVVVGYVLGIMLGWGVVGVWMGMFADWAVRAVLFYWRMVTGRWLWKYP
RPEPQKCEKKPVVSE