Protein Info for b1981 in Escherichia coli BW25113

Name: shiA
Annotation: shikimate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 148 (27 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 383 to 408 (26 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 27 to 236 (210 residues), 67.2 bits, see alignment E=1.4e-22 amino acids 239 to 410 (172 residues), 25.1 bits, see alignment E=8.2e-10 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 30 to 425 (396 residues), 502.9 bits, see alignment E=3.4e-155 PF07690: MFS_1" amino acids 57 to 296 (240 residues), 60.4 bits, see alignment E=1.6e-20 amino acids 298 to 433 (136 residues), 43.8 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 100% identical to SHIA_ECOLI: Shikimate transporter (shiA) from Escherichia coli (strain K12)

KEGG orthology group: K08172, MFS transporter, MHS family, shikimate and dehydroshikimate transport protein (inferred from 100% identity to eco:b1981)

MetaCyc: 100% identical to shikimate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-27

Predicted SEED Role

"Shikimate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76350 at UniProt or InterPro

Protein Sequence (438 amino acids)

>b1981 shikimate transporter (NCBI) (Escherichia coli BW25113)
MDSTLISTRPDEGTLSLSRARRAALGSFAGAVVDWYDFLLYGITAALVFNREFFPQVSPA
MGTLAAFATFGVGFLFRPLGGVIFGHFGDRLGRKRMLMLTVWMMGIATALIGILPSFSTI
GWWAPILLVTLRAIQGFAVGGEWGGAALLSVESAPKNKKAFYSSGVQVGYGVGLLLSTGL
VSLISMMTTDEQFLSWGWRIPFLFSIVLVLGALWVRNGMEESAEFEQQQHYQAAAKKRIP
VIEALLRHPGAFLKIIALRLCELLTMYIVTAFALNYSTQNMGLPRELFLNIGLLVGGLSC
LTIPCFAWLADRFGRRRVYITGTLIGTLSAFPFFMALEAQSIFWIVFFSIMLANIAHDMV
VCVQQPMFTEMFGASYRYSGAGVGYQVASVVGGGFTPFIAAALITYFAGNWHSVAIYLLA
GCLISAMTALLMKDSQRA