Protein Info for b1974 in Escherichia coli BW25113

Name: yodB
Annotation: putative cytochrome (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 3 to 173 (171 residues), 79.5 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 100% identical to C56H_ECOLI: Cytochrome b561 homolog 1 (yodB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1974)

Predicted SEED Role

"Cytochrome b561 homolog 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76345 at UniProt or InterPro

Protein Sequence (176 amino acids)

>b1974 putative cytochrome (VIMSS) (Escherichia coli BW25113)
MNRFSKTQIYLHWITLLFVAITYAAMELRGWFPKGSSTYLLMRETHYNAGIFVWVLMFSR
LIIKHRYSDPSIVPPPPAWQMKAASLMHIMLYITFLALPLLGIALMAYSGKSWSFLGFNV
SPFVTPNSEIKALIKNIHETWANIGYFLIAAHAGAALFHHYIQKDNTLLRMMPRRK