Protein Info for b1951 in Escherichia coli BW25113

Name: rcsA
Annotation: DNA-binding transcriptional activator, co-regulator with RcsB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 79 to 96 (18 residues), see Phobius details PF00196: GerE" amino acids 137 to 191 (55 residues), 68.1 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 100% identical to RCSA_ECO57: Transcriptional regulatory protein RcsA (rcsA) from Escherichia coli O157:H7

KEGG orthology group: K07781, LuxR family transcriptional regulator, capsular biosynthesis positive transcription factor (inferred from 100% identity to eco:b1951)

Predicted SEED Role

"Colanic acid capsular biosynthesis activation accesory protein RcsA, co-regulator with RcsB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0DMC9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>b1951 DNA-binding transcriptional activator, co-regulator with RcsB (NCBI) (Escherichia coli BW25113)
MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIH
DASNSQRIKLIINQHPNTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDI
LKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKI
KTHNKQVIYHVVRLTDNVTNGIFVNMR