Protein Info for b1940 in Escherichia coli BW25113

Name: fliH
Annotation: flagellar biosynthesis; export of flagellar proteins? (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF02108: FliH" amino acids 96 to 219 (124 residues), 140 bits, see alignment E=2.2e-45

Best Hits

Swiss-Prot: 100% identical to FLIH_ECOLI: Flagellar assembly protein FliH (fliH) from Escherichia coli (strain K12)

KEGG orthology group: K02411, flagellar assembly protein FliH (inferred from 100% identity to eco:b1940)

Predicted SEED Role

"Flagellar assembly protein FliH" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31068 at UniProt or InterPro

Protein Sequence (228 amino acids)

>b1940 flagellar biosynthesis; export of flagellar proteins? (VIMSS) (Escherichia coli BW25113)
MSDNLPWKTWTPDDLAPPQAEFVPIVEPEETIIEEAEPSLEQQLAQLQMQAHEQGYQAGI
AEGRQQGHKQGYQEGLAQGLEQGLAEAKSQQAPIHARMQQLVSEFQTTLDALDSVIASRL
MQMALEAARQVIGQTPTVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVDDMLGAT
LSLHGWRLRGDPTLHPGGCKVSADEGDLDASVATRWQELCRLAAPGVV