Protein Info for b1890 in Escherichia coli BW25113

Name: motA
Annotation: flagellar motor protein MotA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 385.1 bits, see alignment E=8.2e-120 PF20560: MotA_N" amino acids 5 to 93 (89 residues), 112.5 bits, see alignment E=9.4e-37 PF01618: MotA_ExbB" amino acids 138 to 239 (102 residues), 48.8 bits, see alignment E=6e-17

Best Hits

Swiss-Prot: 100% identical to MOTA_ECOLI: Motility protein A (motA) from Escherichia coli (strain K12)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to eco:b1890)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P09348 at UniProt or InterPro

Protein Sequence (295 amino acids)

>b1890 flagellar motor protein MotA (NCBI) (Escherichia coli BW25113)
MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA
LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS
VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA
VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQC
VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQQTTTEEA