Protein Info for b1884 in Escherichia coli BW25113

Name: cheR
Annotation: chemotaxis regulator, protein-glutamate methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03705: CheR_N" amino acids 26 to 76 (51 residues), 64 bits, see alignment 7.9e-22 PF01739: CheR" amino acids 92 to 281 (190 residues), 211.1 bits, see alignment E=1.1e-66

Best Hits

Swiss-Prot: 100% identical to CHER_ECOLI: Chemotaxis protein methyltransferase (cheR) from Escherichia coli (strain K12)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to eco:b1884)

MetaCyc: 100% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P07364 at UniProt or InterPro

Protein Sequence (286 amino acids)

>b1884 chemotaxis regulator, protein-glutamate methyltransferase (NCBI) (Escherichia coli BW25113)
MTSSLPCGQTSLLLQMTERLALSDAHFRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRS
LGLTDFGHYLNLLESNQHSGEWQAFINSLTTNLTAFFREAHHFPLLADHARRRSGEYRVW
SAAASTGEEPYSIAMTLADTLGTAPGRWKVFASDIDTEVLEKARSGIYRHEELKNLTPQQ
LQRYFMRGTGPHEGLVRVRQELANYVDFAPLNLLAKQYTVPGPFDAIFCRNVMIYFDQTT
QQEILRRFVPLLKPDGLLFAGHSENFSHLERRFTLRGQTVYALSKD