Protein Info for b1842 in Escherichia coli BW25113

Name: holE
Annotation: DNA polymerase III, theta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06440: DNA_pol3_theta
  • amino acids 4 to 71 (68 residues), 131.2 bits, E=4.5e-43

Best Hits

Swiss-Prot: 100% identical to HOLE_SHIFL: DNA polymerase III subunit theta (holE) from Shigella flexneri

KEGG orthology group: K02345, DNA polymerase III subunit theta [EC: 2.7.7.7] (inferred from 100% identity to eco:b1842)

MetaCyc: 100% identical to DNA polymerase III subunit theta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III theta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

See P0ABS8 at UniProt or InterPro

Protein Sequence (76 amino acids)

>b1842 DNA polymerase III, theta subunit (NCBI) (Escherichia coli BW25113)
MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHR
LASVNLSRLPYEPKLK