Protein Info for b1833 in Escherichia coli BW25113

Name: yebS
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 311 to 339 (29 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 16 to 417 (402 residues), 704.7 bits, see alignment E=1.9e-216 PF04403: PqiA" amino acids 66 to 217 (152 residues), 133.1 bits, see alignment E=4.2e-43 amino acids 263 to 418 (156 residues), 146.9 bits, see alignment E=2.4e-47

Best Hits

Swiss-Prot: 100% identical to YEBS_ECOLI: Intermembrane transport protein YebS (yebS) from Escherichia coli (strain K12)

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 100% identity to eco:b1833)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AD03 at UniProt or InterPro

Protein Sequence (427 amino acids)

>b1833 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MALNTPQITPTKKITVRAIGEELPRGDYQRCPQCDMLFSLPEINSHQSAYCPRCQAKIRD
GRDWSLTRLAAMAFTMLLLMPFAWGEPLLHIWLLGIRIDANVMQGIWQMTKQGDAITGSM
VFFCVIGAPLILVTSIAYLWFGNRLGMNLRPVLLMLERLKEWVMLDIYLVGIGVASIKVQ
DYAHIQAGVGLFSFVALVILTTVTLSHLNVEELWERFYPQRPATRRDEKLRVCLGCHFTG
YPDQRGRCPRCHIPLRLRRRHSLQKCWAALLASIVLLLPANLLPISIIYLNGGRQEDTIL
SGIMSLASSNIAVAGIVFIASILVPFTKVIVMFTLLLSIHFKCQQGLRTRILLLRMVTWI
GRWSMLDLFVISLTMSLINRDQILAFTMGPAAFYFGAAVILTILAVEWLDSRLLWDAHES
GNARFDD