Protein Info for b1821 in Escherichia coli BW25113

Name: b1821
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 68 to 86 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF02659: Mntp" amino acids 31 to 182 (152 residues), 185.8 bits, see alignment E=2.2e-59

Best Hits

Swiss-Prot: 100% identical to MNTP_ECOSM: Probable manganese efflux pump MntP (mntP) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: None (inferred from 100% identity to eco:b1821)

MetaCyc: 100% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76264 at UniProt or InterPro

Protein Sequence (188 amino acids)

>b1821 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML
ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM
AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ
ILWTHFHG