Protein Info for b1798 in Escherichia coli BW25113
Name: yeaS
Annotation: neutral amino-acid efflux system (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to LEUE_ECOHS: Leucine efflux protein (leuE) from Escherichia coli O9:H4 (strain HS)
KEGG orthology group: K11250, leucine efflux protein (inferred from 100% identity to eco:b1798)MetaCyc: 100% identical to leucine exporter (Escherichia coli K-12 substr. MG1655)
RXN0-7050; TRANS-RXN0-270
Predicted SEED Role
"Putative transport protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P76249 at UniProt or InterPro
Protein Sequence (212 amino acids)
>b1798 neutral amino-acid efflux system (NCBI) (Escherichia coli BW25113) MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL AWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSEAKSDEPQYGAIFKRA LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILAATLELVSFCYLSFLIISGAFVTQ YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS