Protein Info for b1794 in Escherichia coli BW25113

Name: yeaP
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF13185: GAF_2" amino acids 17 to 155 (139 residues), 38.2 bits, see alignment E=2.5e-13 PF01590: GAF" amino acids 19 to 154 (136 residues), 35.9 bits, see alignment E=1.5e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 172 to 334 (163 residues), 125.5 bits, see alignment E=8.6e-41 PF00990: GGDEF" amino acids 175 to 330 (156 residues), 140.4 bits, see alignment E=6.9e-45

Best Hits

Swiss-Prot: 100% identical to DGCP_ECOLI: Diguanylate cyclase DgcP (dgcP) from Escherichia coli (strain K12)

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 100% identity to eco:b1794)

MetaCyc: 100% identical to diguanylate cyclase DgcP (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00638308: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76245 at UniProt or InterPro

Protein Sequence (341 amino acids)

>b1794 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MSDQIIARVSQSLAKEQSLESLVRQLLEMLEMVTDMESTYLTKVDVEARLQHIMFARNSQ
KMYIPENFTVSWDYSLCKRAIDENCFFSDEVPDRWGDCIAARNLGITTFLSTPIHLPDGS
FYGTLCAASSEKRQWSERAEQVLQLFAGLIAQYIQKEALVEQLREANAALIAQSYTDSLT
GLPNRRAIFENLTTLFSLARHLNHKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERLN
TLQQNGEVIGRLGGDEFLVVSLNNENADISSLRERIQQQIRGEYHLGDVDLYYPGASLGI
VEVDPETTDADSALHAADIAMYQEKKHKQKTPFVAHPALHS