Protein Info for b1784 in Escherichia coli BW25113

Name: yeaH
Updated annotation (from data): yeaH component of nitrogen-related signalling system (of yeaGH-ycgB)
Rationale: PFam PF04285.8 (DUF444). conserved cofitness; yeaG is a protein kinase
Original annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF04285: DUF444" amino acids 4 to 421 (418 residues), 635.9 bits, see alignment E=1.8e-195

Best Hits

Swiss-Prot: 100% identical to YEAH_ECOLI: UPF0229 protein YeaH (yeaH) from Escherichia coli (strain K12)

KEGG orthology group: K09786, hypothetical protein (inferred from 100% identity to eco:b1784)

Predicted SEED Role

"UPF0229 protein YeaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76235 at UniProt or InterPro

Protein Sequence (427 amino acids)

>b1784 yeaH component of nitrogen-related signalling system (of yeaGH-ycgB) (Escherichia coli BW25113)
MTWFIDRRLNGKNKSMVNRQRFLRRYKAQIKQSISEAINKRSVTDVDSGESVSIPTEDIS
EPMFHQGRGGLRHRVHPGNDHFVQNDRIERPQGGGGGSGSGQGQASQDGEGQDEFVFQIS
KDEYLDLLFEDLALPNLKQNQQRQLTEYKTHRAGYTANGVPANISVVRSLQNSLARRTAM
TAGKRRELHALEENLAIISNSEPAQLLEEERLRKEIAELRAKIERVPFIDTFDLRYKNYE
KRPDPSSQAVMFCLMDVSGSMDQSTKDMAKRFYILLYLFLSRTYKNVEVVYIRHHTQAKE
VDEHEFFYSQETGGTIVSSALKLMDEVVKERYNPAQWNIYAAQASDGDNWADDSPLCHEI
LAKKLLPVVRYYSYIEITRRAHQTLWREYEHLQSTFDNFAMQHIRDQDDIYPVFRELFHK
QNATAKG