Protein Info for b1779 in Escherichia coli BW25113

Name: gapA
Annotation: glyceraldehyde-3-phosphate dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to G3P1_ECO57: Glyceraldehyde-3-phosphate dehydrogenase A (gapA) from Escherichia coli O157:H7

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to eco:b1779)

MetaCyc: 100% identical to glyceraldehyde-3-phosphate dehydrogenase A (Escherichia coli K-12 substr. MG1655)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
superpathway of N-acetylneuraminate degradation (22/22 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
superpathway of hexitol degradation (bacteria) (18/18 steps found)
superpathway of glucose and xylose degradation (17/17 steps found)
superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
gluconeogenesis I (13/13 steps found)
glycolysis I (from glucose 6-phosphate) (13/13 steps found)
homolactic fermentation (12/12 steps found)
superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
superpathway of anaerobic sucrose degradation (17/19 steps found)
glycolysis II (from fructose 6-phosphate) (11/11 steps found)
glycolysis III (from glucose) (11/11 steps found)
heterolactic fermentation (16/18 steps found)
Entner-Doudoroff pathway I (9/9 steps found)
Bifidobacterium shunt (13/15 steps found)
superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
glycolysis IV (8/10 steps found)
sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
gluconeogenesis III (9/12 steps found)
glycolysis VI (from fructose) (8/11 steps found)
glycerol degradation to butanol (11/16 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9B2 at UniProt or InterPro

Protein Sequence (331 amino acids)

>b1779 glyceraldehyde-3-phosphate dehydrogenase (NCBI) (Escherichia coli BW25113)
MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEV
KDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMT
GPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATT
ATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV
VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK