Protein Info for b1778 in Escherichia coli BW25113

Name: yeaA
Annotation: methionine sulfoxide reductase B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR00357: methionine-R-sulfoxide reductase" amino acids 4 to 136 (133 residues), 225.8 bits, see alignment E=7.4e-72 PF01641: SelR" amino acids 14 to 127 (114 residues), 177.1 bits, see alignment E=5.5e-57

Best Hits

Swiss-Prot: 100% identical to MSRB_ECO27: Peptide methionine sulfoxide reductase MsrB (msrB) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to eco:b1778)

MetaCyc: 100% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A746 at UniProt or InterPro

Protein Sequence (137 amino acids)

>b1778 methionine sulfoxide reductase B (NCBI) (Escherichia coli BW25113)
MANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKY
DSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVN
SASLRFTDGENGEEING