Protein Info for b1775 in Escherichia coli BW25113

Name: ydjK
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 406 (379 residues), 117.8 bits, see alignment E=5.3e-38 PF00083: Sugar_tr" amino acids 56 to 452 (397 residues), 117 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 100% identical to YDJK_ECOLI: Putative metabolite transport protein YdjK (ydjK) from Escherichia coli (strain K12)

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to eco:b1775)

Predicted SEED Role

"Putative transport protein YdjK, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76230 at UniProt or InterPro

Protein Sequence (459 amino acids)

>b1775 predicted transporter (NCBI) (Escherichia coli BW25113)
MEQITKPHCGARLDRLPDCRWHSSMFAIVAFGLLVCWSNAVGGLILAQLKALGWTDNSTT
ATFSAITTAGMFLGALVGGIIGDKTGRRNAFILYEAIHIASMVVGAFSPNMDFLIACRFV
MGVGLGALLVTLFAGFTEYMPGRNRGTWSSRVSFIGNWSYPLCSLIAMGLTPLISAEWNW
RVQLLIPAILSLIATALAWRYFPESPRWLESRGRYQEAEKVMRSIEEGVIRQTGKPLPPV
VIADDGKAPQAVPYSALLTGVLLKRVILGSCVLIAMNVVQYTLINWLPTIFMTQGINLKD
SIVLNTMSMFGAPFGIFIAMLVMDKIPRKTMGVGLLILIAVLGYIYSLQTSMLLITLIGF
FLITFVYMYVCYASAVYVPEIWPTEAKLRGSGLANAVGRISGIAAPYAVAVLLSSYGVTG
VFILLGAVSIIVAIAIATIGIETKGVSVESLSIDAVANK