Protein Info for b1758 in Escherichia coli BW25113

Name: b1758
Annotation: putative cytochrome oxidase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 33 to 60 (28 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 172 to 174 (3 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 27 to 182 (156 residues), 42.1 bits, see alignment E=6.3e-15

Best Hits

Swiss-Prot: 100% identical to YNJF_ECOLI: Inner membrane protein YnjF (ynjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1758)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76226 at UniProt or InterPro

Protein Sequence (206 amino acids)

>b1758 putative cytochrome oxidase (VIMSS) (Escherichia coli BW25113)
MLDRHLHPRIKPLLHQCVRVLDKPGITPDGLTLVGFAIGVLALPFLALGWYLAALVVILL
NRLLDGLDGALARRRELTDAGGFLDISLDFLFYALVPFGFILAAPEQNALAGGWLLFAFI
GTGSSFLAFAALAAKHQIDNPGYAHKSFYYLGGLTEGTETILLFVLGCLFPAWFAWFAWI
FGALCWMTTFTRVWSGYLTLKSLQRQ