Protein Info for b1752 in Escherichia coli BW25113

Name: ydjZ
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 55 to 74 (20 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details PF09335: VTT_dom" amino acids 81 to 197 (117 residues), 87.4 bits, see alignment E=5.6e-29

Best Hits

Swiss-Prot: 100% identical to YDJZ_ECOLI: TVP38/TMEM64 family inner membrane protein YdjZ (ydjZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1752)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76221 at UniProt or InterPro

Protein Sequence (235 amino acids)

>b1752 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MMMMQSRKIWYYRITLIILLFAMLLAWALLPGVHEFINRSVAAFAAVDQQGIERFIQSYG
ALAAVVSFLLMILQAIAAPLPAFLITFANASLFGAFWGGLLSWTSSMAGAALCFFIARVM
GREVVEKLTGKTVLDSMDGFFTRYGKHTILVCRLLPFVPFDPISYAAGLTSIRFRSFFIA
TGLGQLPATIVYSWAGSMLTGGTFWFVTGLFILFALTVVIFMAKKIWLERQKRNA