Protein Info for b1738 in Escherichia coli BW25113

Name: chbB
Annotation: N,N'-diacetylchitobiose-specific enzyme IIB component of PTS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PTQB_ECOLI: PTS system N,N'-diacetylchitobiose-specific EIIB component (chbB) from Escherichia coli (strain K12)

KEGG orthology group: K02760, PTS system, cellobiose-specific IIB component [EC: 2.7.1.69] (inferred from 100% identity to eco:b1738)

MetaCyc: 100% identical to N,N'-diacetylchitobiose-specific PTS enzyme IIB component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-155B [EC: 2.7.1.196]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.196 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69795 at UniProt or InterPro

Protein Sequence (106 amino acids)

>b1738 N,N'-diacetylchitobiose-specific enzyme IIB component of PTS (NCBI) (Escherichia coli BW25113)
MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI
AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN