Protein Info for b1733 in Escherichia coli BW25113

Name: chbG
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF04794: YdjC" amino acids 5 to 237 (233 residues), 196.1 bits, see alignment E=5.8e-62

Best Hits

Swiss-Prot: 100% identical to CHBG_ECOBW: Chitooligosaccharide deacetylase (chbG) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03478, hypothetical protein (inferred from 100% identity to eco:b1733)

MetaCyc: 100% identical to chitooligosaccharide monodeacetylase ChbG (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37794 at UniProt or InterPro

Protein Sequence (249 amino acids)

>b1733 hypothetical protein (NCBI) (Escherichia coli BW25113)
MERLLIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDHAVQLSRDEPSLAIGM
HFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQELVSQYLRFIELFGRKPT
HLDSHHHVHMFPQIFPIVARFAAEQGIALRADRQMAFDLPVNLRTTQGFSSAFYGEEISE
SLFLQVLDDAGHRGDRSLEVMCHPAFIDNTIRQSAYCFPRLTELDVLTSASLKGAIAQRG
YRLGSYRDV