Protein Info for b1731 in Escherichia coli BW25113

Name: cedA
Annotation: cell division modulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 PF10729: CedA" amino acids 3 to 78 (76 residues), 153.7 bits, see alignment E=4.6e-50

Best Hits

Swiss-Prot: 100% identical to CEDA_ECO24: Cell division activator CedA (cedA) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: None (inferred from 100% identity to eco:b1731)

Predicted SEED Role

"Cell division activator cedA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE60 at UniProt or InterPro

Protein Sequence (80 amino acids)

>b1731 cell division modulator (RefSeq) (Escherichia coli BW25113)
MKKPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVAFVLMGESFLRSPAFT
VPESAQRWANQIRQEGEVTE