Protein Info for b1727 in Escherichia coli BW25113

Name: yniC
Annotation: predicted hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 9 to 184 (176 residues), 88.5 bits, E=7.8e-29
• PF13419: HAD_2
  • amino acids 11 to 191 (181 residues), 80.1 bits, E=2.2e-26
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 89 to 191 (103 residues), 41.6 bits, E=7.1e-15

Best Hits

Swiss-Prot: 100% identical to HXPB_ECOLI: Hexitol phosphatase B (hxpB) from Escherichia coli (strain K12)

KEGG orthology group: K01112, [EC: 3.1.3.-] (inferred from 100% identity to eco:b1727)

MetaCyc: 100% identical to hexitol phosphatase B (Escherichia coli K-12 substr. MG1655)
2-deoxyglucose-6-phosphatase. [EC: 3.1.3.68]; Sorbitol-6-phosphatase. [EC: 3.1.3.68, 3.1.3.50]; Mannitol-1-phosphatase. [EC: 3.1.3.68, 3.1.3.50, 3.1.3.22]

Predicted SEED Role

"2-deoxyglucose-6-phosphate hydrolase YniC" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

• mannitol cycle (4/5 steps found)
• 2-deoxy-D-glucose 6-phosphate degradation (3/4 steps found)
• D-sorbitol biosynthesis I (2/3 steps found)
• mannitol biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.22 or 3.1.3.50 or 3.1.3.68

Sequence Analysis Tools

See P77247 at UniProt or InterPro

Protein Sequence (222 amino acids)

>b1727 predicted hydrolase (NCBI) (Escherichia coli BW25113)
MSTPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDL
WYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLH
MLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIA
SKAARMRSIVVPAPEAQNDPRFVLADVKLSSLTELTAKDLLG