Protein Info for b1710 in Escherichia coli BW25113

Name: btuE
Annotation: predicted glutathione peroxidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 6 to 111 (106 residues), 158.9 bits, E=1.5e-51

Best Hits

Swiss-Prot: 100% identical to BTUE_ECOLI: Thioredoxin/glutathione peroxidase BtuE (btuE) from Escherichia coli (strain K12)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 100% identity to eco:b1710)

MetaCyc: 100% identical to thioredoxin/glutathione peroxidase BtuE (Escherichia coli K-12 substr. MG1655)
Glutathione peroxidase. [EC: 1.11.1.9]; RXN0-267 [EC: 1.11.1.9, 1.11.1.24]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.24 or 1.11.1.9

Sequence Analysis Tools

See P06610 at UniProt or InterPro

Protein Sequence (183 amino acids)

>b1710 predicted glutathione peroxidase (NCBI) (Escherichia coli BW25113)
MQDSILTTVVKDIDGEVTTLEKFAGNVLLIVNVASKCGLTPQYEQLENIQKAWVDRGFMV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLA
LAK