Protein Info for b1706 in Escherichia coli BW25113

Name: ydiU
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF02696: SelO" amino acids 2 to 450 (449 residues), 510.9 bits, see alignment E=1.7e-157

Best Hits

Swiss-Prot: 100% identical to SELO_ECODH: Protein adenylyltransferase SelO (selO) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K08997, hypothetical protein (inferred from 100% identity to eco:b1706)

MetaCyc: 100% identical to protein adenylyltransferase SelO (Escherichia coli K-12 substr. MG1655)
RXN0-7371 [EC: 2.7.7.108]

Predicted SEED Role

"Selenoprotein O and cysteine-containing homologs"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77649 at UniProt or InterPro

Protein Sequence (478 amino acids)

>b1706 hypothetical protein (NCBI) (Escherichia coli BW25113)
MTLSFVTRWRDELPETYTALSPTPLNNARLIWHNTELANTLSIPSSLFKNGAGVWGGEAL
LPGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLLADGTTMDWHLKGAGLTPYSRMGDG
RAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDSPVYRETAEPGAMLMRVAPSHLRFGH
FEHFYYRRESEKVRQLADFAIRHYWSHLADDEDKYRLWFSDVVARTASLIAQWQTVGFAH
GVMNTDNMSLLGLTLDYGPFGFLDDYEPGFICNHSDHQGRYSFDNQPAVALWNLQRLAQT
LSPFVAVDALNEALDSYQQVLLTHYGERMRQKLGFMTEQKEDNALLNELFSLMARERSDY
TRTFRMLSLTEQHSAASPLRDEFIDRAAFDDWFARYRGRLQQDEVSDSERQQLMQSVNPA
LVLRNWLAQRAIEAAEKGDMTELHRLHEALRNPFSDRDDDYVSRPPDWGKRLEVSCSS