Protein Info for b1699 in Escherichia coli BW25113

Name: ydiS
Annotation: predicted oxidoreductase with FAD/NAD(P)-binding domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 6 to 8 (3 residues), see Phobius details transmembrane" amino acids 9 to 26 (18 residues), see Phobius details PF01494: FAD_binding_3" amino acids 6 to 182 (177 residues), 51.1 bits, see alignment E=5.6e-17 PF03486: HI0933_like" amino acids 7 to 165 (159 residues), 28.2 bits, see alignment E=3.9e-10 PF12831: FAD_oxidored" amino acids 7 to 157 (151 residues), 38.3 bits, see alignment E=4.9e-13 PF00890: FAD_binding_2" amino acids 7 to 42 (36 residues), 23 bits, see alignment 2e-08 PF01266: DAO" amino acids 7 to 54 (48 residues), 32.6 bits, see alignment 3e-11 amino acids 109 to 328 (220 residues), 31 bits, see alignment E=8.9e-11 PF13450: NAD_binding_8" amino acids 10 to 41 (32 residues), 27.8 bits, see alignment (E = 1.1e-09) PF21162: ETFQO_UQ-bd" amino acids 181 to 280 (100 residues), 37.1 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 100% identical to YDIS_ECOLI: Probable electron transfer flavoprotein-quinone oxidoreductase YdiS (ydiS) from Escherichia coli (strain K12)

KEGG orthology group: K00313, electron transfer flavoprotein-quinone oxidoreductase [EC: 1.5.5.-] (inferred from 100% identity to eco:b1699)

MetaCyc: 38% identical to quinone reductase (NADH,flavodoxin) complex electron transfer catalytic subunit (Azotobacter vinelandii)
1.19.1.M1 [EC: 1.19.1.M1]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 1.5.5.-

Use Curated BLAST to search for 1.19.1.M1 or 1.5.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77337 at UniProt or InterPro

Protein Sequence (429 amino acids)

>b1699 predicted oxidoreductase with FAD/NAD(P)-binding domain (NCBI) (Escherichia coli BW25113)
MSDDKFDAIVVGAGVAGSVAALVMARAGLDVLVIERGDSAGCKNMTGGRLYAHTLEAIIP
GFAVSAPVERKVTREKISFLTEESAVTLDFHREQPDVPQHASYTVLRNRLDPWLMEQAEQ
AGAQFIPGVRVDALVREGNKVTGVQAGDDILEANVVILADGVNSMLGRSLGMVPASDPHH
YAVGVKEVIGLTPEQINDRFNITGEEGAAWLFAGSPSDGLMGGGFLYTNKDSISLGLVCG
LGDIAHAQKSVPQMLEDFKQHPAIRPLISGGKLLEYSAHMVPEGGLAMVPQLVNEGVMIV
GDAAGFCLNLGFTVRGMDLAIASAQAAATTVIAAKERADFSASSLAQYKRELEQSCVMRD
MQHFRKIPALMENPRLFSQYPRMVADIMNEMFTIDGKPNQPVRKMIMGHAKKIGLINLLK
DGIKGATAL