Protein Info for b1688 in Escherichia coli BW25113

Name: ydiK
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 53 (17 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 192 to 208 (17 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 243 to 271 (29 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 307 to 334 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 344 (330 residues), 217.1 bits, see alignment E=1.9e-68

Best Hits

Swiss-Prot: 100% identical to YDIK_ECOLI: Putative transport protein YdiK (ydiK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1688)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFS7 at UniProt or InterPro

Protein Sequence (370 amino acids)

>b1688 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MVNVRQPRDVAQILLSVLFLAIMIVACLWIVQPFILGFAWAGTVVIATWPVLLRLQKIMF
GRRSLAVLVMTLLLVMVFIIPIALLVNSIVDGSGPLIKAISSGDMTLPDLAWLNTIPVIG
AKLYAGWHNLLDMGGTAIMAKVRPYIGTTTTWFVGQAAHIGRFMVHCALMLLFSALLYWR
GEQVAQGIRHFATRLAGVRGDAAVLLAAQAIRAVALGVVVTALVQAVLGGIGLAVSGVPY
ATLLTVLMILSCLVQLGPLPVLIPAIIWLYWTGDTTWGTVLLVWSGVVGTLDNVIRPMLI
RMGADLPLILILSGVIGGLIAFGMIGLFIGPVLLAVSWRLFAAWVEEVPPPTDQPEEILE
ELGEIEKPNK