Protein Info for b1686 in Escherichia coli BW25113

Name: ydiI
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 19 to 134 (116 residues), 158.9 bits, E=2.4e-51
• PF03061: 4HBT
  • amino acids 50 to 127 (78 residues), 66.6 bits, E=1e-22

Best Hits

Swiss-Prot: 100% identical to MENI_ECOLI: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (menI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1686)

MetaCyc: 100% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis" (EC 3.1.2.28)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

See P77781 at UniProt or InterPro

Protein Sequence (136 amino acids)

>b1686 hypothetical protein (NCBI) (Escherichia coli BW25113)
MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVV
LAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFD
EKGRLCCSSRLTTAIL