Protein Info for b1678 in Escherichia coli BW25113

Name: ynhG
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01476: LysM" amino acids 42 to 85 (44 residues), 34 bits, see alignment 3.3e-12 PF03734: YkuD" amino acids 97 to 232 (136 residues), 85.7 bits, see alignment E=7.4e-28 PF17969: Ldt_C" amino acids 236 to 302 (67 residues), 88 bits, see alignment E=8.2e-29

Best Hits

Swiss-Prot: 100% identical to YNHG_ECOLI: Probable L,D-transpeptidase YnhG (ynhG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1678)

MetaCyc: 100% identical to L,D-transpeptidase LdtE (Escherichia coli K-12 substr. MG1655)
RXN-16660

Predicted SEED Role

"L,D-transpeptidase YnhG"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76193 at UniProt or InterPro

Protein Sequence (334 amino acids)

>b1678 hypothetical protein (NCBI) (Escherichia coli BW25113)
MKRASLLTLTLIGAFSAIQAAWAVDYPLPPTGSRLVGQNQTYTVQEGDKNLQAIARRFDT
AAMLILEANNTIAPVPKPGTTITIPSQLLLPDAPRQGIIVNLAELRLYYYPPGENIVQVY
PIGIGLQGLETPVMETRVGQKIPNPTWTPTAGIRQRSLERGIKLPPVVPAGPNNPLGRYA
LRLAHGNGEYLIHGTSAPDSVGLRVSSGCIRMNAPDIKALFSSVRTGTPVKVINEPVKYS
VEPNGMRYVEVHRPLSAEEQQNVQTMPYTLPAGFTQFKDNKAVDQKLVDKALYRRAGYPV
SVSSGATPAASNAPSVESAQNGEPEQGNMLRVTQ