Protein Info for b1664 in Escherichia coli BW25113

Name: ydhQ
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF16168: AIDA" amino acids 99 to 159 (61 residues), 79.3 bits, see alignment E=1.8e-26 TIGR04415: autotransporter passenger strand-loop-strand repeat" amino acids 149 to 179 (31 residues), 21 bits, see alignment (E = 1.3e-08) PF03212: Pertactin" amino acids 329 to 403 (75 residues), 24.6 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 100% identical to YDHQ_ECOLI: Uncharacterized protein YdhQ (ydhQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1664)

Predicted SEED Role

"Possible enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77552 at UniProt or InterPro

Protein Sequence (418 amino acids)

>b1664 hypothetical protein (NCBI) (Escherichia coli BW25113)
MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTVVTGAGWLKVATGGIA
KCTQYGNNGTLSVSDGAIATDIVQSEGGAISLSTLATVNGRHPEGEFSVDKGYACGLLLE
NGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGELLVYPGGEASNCEINQGGVF
MLAGKASDTLLAGGTMNNLGGEDSDTIVENGSIYRLGTDGLQLYSSGKTQNLSVNVGGRA
EVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELTGSVALLDGASMIIGYGAEL
QQSTITVQQGGVLILDGSTVKGDSVTFIVGNINLNGGKLWLITDAATHVQLKVKRLRGEG
AICLQTSAKEISPDFINVKGEVTGDIHVEITDASRQTLCNALKLQPDEDGIGATLQPA