Protein Info for b1645 in Escherichia coli BW25113

Name: ydhK
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 437 to 454 (18 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 494 to 512 (19 residues), see Phobius details amino acids 568 to 585 (18 residues), see Phobius details PF04632: FUSC" amino acids 20 to 662 (643 residues), 467 bits, see alignment E=1.2e-143 PF13515: FUSC_2" amino acids 33 to 163 (131 residues), 62.7 bits, see alignment E=3.8e-21

Best Hits

Swiss-Prot: 100% identical to YDHK_ECOLI: Uncharacterized transporter YdhK (ydhK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1645)

Predicted SEED Role

"FIG01045166: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76186 at UniProt or InterPro

Protein Sequence (670 amino acids)

>b1645 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MNASSWSLRNLPWFRATLAQWRYALRNTIAMCLALTVAYYLNLDEPYWAMTSAAVVSFPT
VGGVISKSLGRIAGSLLGAIAALLLAGHTLNEPWFFLLSMSAWLGFCTWACAHFTNNVAY
AFQLAGYTAAIIAFPMVNITEASQLWDIAQARVCEVIVGILCGGMMMMILPSSSDATALL
TALKNMHARLLEHASLLWQPETTDAIRAAHEGVIGQILTMNLLRIQAFWSHYRFRQQNAR
LNALLHQQLRMTSVISSLRRMLLNWPSPPGATREILEQLLTALASSQTDVYTVARIIAPL
RPTNVADYRHVAFWQRLRYFCRLYLQSSQELHRLQSGVDDHTRLPRTSGLARHTDNAEAM
WSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLYSAVAAPFKSLSLLMRTLVLLS
LFSFVVKFGLMVQISDLWQFLLFLFPLLATMQLLKLQMPKFAALWGQLIVFMGSFIAVTN
PPVYDFADFLNDNLAKIVGVALAWLAFAILRPGSDARKSRRHIRALRRDFVDQLSRHPTL
SESEFESLTYHHVSQLSNSQDALARRWLLRWGVVLLNCSHVVWQLRDWESRSDPLSRVRD
NCISLLRGVMSERGVQQKSLAATLEELQRICDSLARHHQPAARELAAIVWRLYCSLSQLE
QAPPQGTLAS