Protein Info for b1644 in Escherichia coli BW25113

Name: b1644
Annotation: putative membrane protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 230 (190 residues), 134.7 bits, see alignment E=1.8e-43 PF25917: BSH_RND" amino acids 43 to 184 (142 residues), 90.2 bits, see alignment E=1.6e-29 PF25876: HH_MFP_RND" amino acids 85 to 152 (68 residues), 78.2 bits, see alignment E=1.1e-25 PF25878: HH_AAEA_pHBA" amino acids 86 to 149 (64 residues), 33.8 bits, see alignment E=1e-11 PF25963: Beta-barrel_AAEA" amino acids 187 to 283 (97 residues), 107 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 100% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1644)

MetaCyc: 40% identical to aromatic carboxylic acid efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-233

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76185 at UniProt or InterPro

Protein Sequence (285 amino acids)

>b1644 putative membrane protein (VIMSS) (Escherichia coli BW25113)
MSIKTIKYFSTIIVAVVAVLAGWWLWNYYMQSPWTRDGKIRAEQVSITPQVSGRIVELNI
KDNQLVNAGDLLLTIDKTPFQIAELNAQAQLAKAQSDLAKANNEANRRRHLSQNFISAEE
LDTANLNVKAMQASVDAAQATLKQAQWQLAQTEIRAPVSGWVTNLTTRIGDYADTGKPLF
ALVDSHSFYVIGYFEETKLRHIREGAPAQITLYSDNKTLQGHVSSIGRAIYDQSVESDSS
LIPDVKPNVPWVRLAQRVPVRFALDKVPGDVTLVSGTTCSIAVGQ