Protein Info for b1624 in Escherichia coli BW25113

Name: b1624
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF01408: GFO_IDH_MocA" amino acids 5 to 122 (118 residues), 102.1 bits, see alignment E=3.3e-33 PF02894: GFO_IDH_MocA_C" amino acids 134 to 344 (211 residues), 178.7 bits, see alignment E=1.5e-56

Best Hits

Swiss-Prot: 100% identical to YDGJ_ECOLI: Uncharacterized oxidoreductase YdgJ (ydgJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1624)

MetaCyc: 39% identical to scyllo-inositol dehydrogenase (NADP+) (Bacillus subtilis subtilis 168)
RXN-14347 [EC: 1.1.1.371]

Predicted SEED Role

"Uncharacterized oxidoreductase ydgJ (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.371

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77376 at UniProt or InterPro

Protein Sequence (346 amino acids)

>b1624 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MSDNIRVGLIGYGYASKTFHAPLIAGTPGQELAVISSSDETKVKADWPTVTVVSEPKHLF
NDPNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELDALAKSLGRVLSV
FHNRRWDSDFLTLKGLLAEGVLGEVAYFESHFDRFRPQVRDRWREQGGPGSGIWYDLAPH
LLDQAITLFGLPVSMTVDLAQLRPGAQSTDYFHAILSYPQRRVILHGTMLAAAESARYIV
HGSRGSYVKYGLDPQEERLKNGERLPQEDWGYDMRDGVLTRVEGEERVEETLLTVPGNYP
AYYAAIRDALNGDGENPVPASQAIQVMELIELGIESAKHRATLCLA