Protein Info for b1621 in Escherichia coli BW25113

Name: malX
Annotation: fused maltose and glucose-specific PTS enzymes: IIB component -! IIC component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 58 to 66 (9 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 322 to 338 (17 residues), see Phobius details amino acids 343 to 377 (35 residues), see Phobius details amino acids 379 to 392 (14 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details TIGR02004: PTS system, maltose and glucose-specific IIBC component" amino acids 8 to 525 (518 residues), 853 bits, see alignment E=1.1e-260 PF02378: PTS_EIIC" amino acids 19 to 361 (343 residues), 287.4 bits, see alignment E=1.4e-89 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 70 to 372 (303 residues), 329.2 bits, see alignment E=3.4e-102 TIGR00826: PTS system, glucose-like IIB component" amino acids 420 to 511 (92 residues), 92.7 bits, see alignment E=2.1e-30 PF00367: PTS_EIIB" amino acids 454 to 486 (33 residues), 60.3 bits, see alignment (E = 9.3e-21)

Best Hits

Swiss-Prot: 100% identical to PTOCB_ECOLI: PTS system maltose-specific EIICB component (malX) from Escherichia coli (strain K12)

KEGG orthology group: K02790, PTS system, maltose and glucose-specific IIB component [EC: 2.7.1.69] K02791, PTS system, maltose and glucose-specific IIC component (inferred from 100% identity to eco:b1621)

MetaCyc: 100% identical to PTS enzyme IIBC component MalX (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-574; TRANS-RXN0-575

Predicted SEED Role

"PTS system, maltose and glucose-specific IIC component (EC 2.7.1.69) / PTS system, maltose and glucose-specific IIB component (EC 2.7.1.69)" in subsystem Maltose and Maltodextrin Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P19642 at UniProt or InterPro

Protein Sequence (530 amino acids)

>b1621 fused maltose and glucose-specific PTS enzymes: IIB component -! IIC component (NCBI) (Escherichia coli BW25113)
MTAKTAPKVTLWEFFQQLGKTFMLPVALLSFCGIMLGIGSSLSSHDVITLIPVLGNPVLQ
AIFTWMSKIGSFAFSFLPVMFCIAIPLGLARENKGVAAFAGFIGYAVMNLAVNFWLTNKG
ILPTTDAAVLKANNIQSILGIQSIDTGILGAVIAGIIVWMLHERFHNIRLPDALAFFGGT
RFVPIISSLVMGLVGLVIPLVWPIFAMGISGLGHMINSAGDFGPMLFGTGERLLLPFGLH
HILVALIRFTDAGGTQEVCGQTVSGALTIFQAQLSCPTTHGFSESATRFLSQGKMPAFLG
GLPGAALAMYHCARPENRHKIKGLLISGLIACVVGGTTEPLEFLFLFVAPVLYVIHALLT
GLGFTVMSVLGVTIGNTDGNIIDFVVFGILHGLSTKWYMVPVVAAIWFVVYYVIFRFAIT
RFNLKTPGRDSEVASSIEKAVAGAPGKSGYNVPAILEALGGADNIVSLDNCITRLRLSVK
DMSLVNVQALKDNRAIGVVQLNQHNLQVVIGPQVQSVKDEMAGLMHTVQA