Protein Info for b1613 in Escherichia coli BW25113

Name: manA
Annotation: mannose-6-phosphate isomerase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF20511: PMI_typeI_cat" amino acids 1 to 150 (150 residues), 170 bits, see alignment E=6.7e-54 TIGR00218: mannose-6-phosphate isomerase, class I" amino acids 3 to 384 (382 residues), 487.2 bits, see alignment E=1.6e-150 PF20512: PMI_typeI_hel" amino acids 157 to 236 (80 residues), 74.2 bits, see alignment E=2e-24 PF01238: PMI_typeI_C" amino acids 310 to 357 (48 residues), 59.8 bits, see alignment 4.5e-20 PF21621: MPI_cupin_dom" amino acids 311 to 389 (79 residues), 89.2 bits, see alignment E=2.6e-29

Best Hits

Swiss-Prot: 100% identical to MANA_ECOLI: Mannose-6-phosphate isomerase (manA) from Escherichia coli (strain K12)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 100% identity to eco:b1613)

MetaCyc: 100% identical to mannose-6-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Mannose-6-phosphate isomerase. [EC: 5.3.1.8]

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P00946 at UniProt or InterPro

Protein Sequence (391 amino acids)

>b1613 mannose-6-phosphate isomerase (VIMSS) (Escherichia coli BW25113)
MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRD
VIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMD
AAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERL
SELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISEFYPEDSGLFSPLLLNVVK
LNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEAKPANQ
LLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDATLWKGSQQLQ
LKPGESAFIAANESPVTVKGHGRLARVYNKL