Protein Info for b1609 in Escherichia coli BW25113

Name: rstB
Annotation: sensory histidine kinase in two-component regulatory system with RstA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 118 to 130 (13 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details PF00672: HAMP" amino acids 163 to 206 (44 residues), 34.6 bits, see alignment 3e-12 PF00512: HisKA" amino acids 212 to 270 (59 residues), 36.2 bits, see alignment E=7.6e-13 PF02518: HATPase_c" amino acids 318 to 423 (106 residues), 87.4 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 100% identical to RSTB_ECOLI: Sensor protein RstB (rstB) from Escherichia coli (strain K12)

KEGG orthology group: K07639, two-component system, OmpR family, sensor histidine kinase RstB [EC: 2.7.13.3] (inferred from 100% identity to eco:b1609)

MetaCyc: 100% identical to sensor histidine kinase RstB (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18392 at UniProt or InterPro

Protein Sequence (433 amino acids)

>b1609 sensory histidine kinase in two-component regulatory system with RstA (NCBI) (Escherichia coli BW25113)
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLVQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFS
WPLWHNIPQFTSA