Protein Info for b1606 in Escherichia coli BW25113

Name: folM
Annotation: short chain dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00106: adh_short" amino acids 9 to 184 (176 residues), 65.2 bits, see alignment E=5.7e-22 PF13561: adh_short_C2" amino acids 18 to 238 (221 residues), 77.7 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 100% identical to FOLM_ECOHS: Dihydromonapterin reductase (folM) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K13938, dihydromonapterin reductase / dihydrofolate reductase [EC: 1.5.1.- 1.5.1.3] (inferred from 100% identity to eco:b1606)

MetaCyc: 100% identical to dihydromonapterin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6367 [EC: 1.5.1.50]; Dihydrofolate reductase. [EC: 1.5.1.50, 1.5.1.3]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.1.3

Use Curated BLAST to search for 1.5.1.- or 1.5.1.3 or 1.5.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFS3 at UniProt or InterPro

Protein Sequence (240 amino acids)

>b1606 short chain dehydrogenase (NCBI) (Escherichia coli BW25113)
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR