Protein Info for b1596 in Escherichia coli BW25113

Name: ynfM
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details amino acids 326 to 352 (27 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 260 (220 residues), 105.3 bits, see alignment E=3.3e-34 amino acids 266 to 408 (143 residues), 45.9 bits, see alignment E=3.8e-16 PF00083: Sugar_tr" amino acids 72 to 217 (146 residues), 46.7 bits, see alignment E=2.3e-16

Best Hits

Swiss-Prot: 100% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 100% identity to eco:b1596)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P43531 at UniProt or InterPro

Protein Sequence (417 amino acids)

>b1596 predicted transporter (NCBI) (Escherichia coli BW25113)
MSRTTTVDGAPASDTDKQSISQPNQFIKRGTPQFMRVTLALFSAGLATFALLYCVQPILP
VLSQEFGLTPANSSISLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASICTLLSTM
MTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLIS
GVFTDFFNWRIALAAIGCFALASALMFWKILPESRHFRPTSLRPKTLFINFRLHWRDRGL
PLLFAEGFLLMGSFVTLFNYIGYRLMLSPWHVSQAVVGLLSLAYLTGTWSSPKAGTMTTR
YGRGPVMLFSTGVMLFGLLMTLFSSLWLIFAGMLLFSAGFFAAHSVASSWIGPRAKRAKG
QASSLYLFSYYLGSSIAGTLGGVFWHNYGWNGVGAFIALMLVIALLVGTRLHRRLHA