Protein Info for b1594 in Escherichia coli BW25113

Name: dgsA
Annotation: DNA-binding transcriptional repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF00480: ROK" amino acids 89 to 389 (301 residues), 176.7 bits, see alignment E=4e-56

Best Hits

Swiss-Prot: 100% identical to MLC_ECOLI: Protein mlc (mlc) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1594)

Predicted SEED Role

"Mlc, transcriptional repressor of MalT (the transcriptional activator of maltose regulon) and manXYZ operon" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P50456 at UniProt or InterPro

Protein Sequence (406 amino acids)

>b1594 DNA-binding transcriptional repressor (NCBI) (Escherichia coli BW25113)
MVAENQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLV
QELEIKEAGNRGRPAVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKD
DLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGE
ALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSS
SLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSL
CQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIR
QQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG