Protein Info for b1592 in Escherichia coli BW25113

Name: b1592
Annotation: putative chloride channel (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 54 to 71 (18 residues), see Phobius details amino acids 107 to 111 (5 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 168 to 171 (4 residues), see Phobius details amino acids 174 to 200 (27 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 60 to 402 (343 residues), 273.7 bits, see alignment E=1.2e-85

Best Hits

Swiss-Prot: 100% identical to CLCB_ECODH: Voltage-gated ClC-type chloride channel ClcB (clcB) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to eco:b1592)

MetaCyc: 100% identical to putative chloride:H+ antiporter ClcB (Escherichia coli K-12 substr. MG1655)
RXN0-2501

Predicted SEED Role

"FIG00509904: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76175 at UniProt or InterPro

Protein Sequence (418 amino acids)

>b1592 putative chloride channel (VIMSS) (Escherichia coli BW25113)
MFHRLLIATVVGILAAFAVAGFRHAMLLLEWLFLNNDSGSLVNAATNLSPWRRLLTPALG
GLAAGLLLMGWQKFTQQRPHAPTDYMEALQTDGQFDYAASLVKSLASLLVVTSGSAIGRE
GAMILLAALAASCFAQRFTPRQEWKLWIACGAAAGMAAAYRAPLAGSLFIAEVLFGTMML
ASLGPVIISAVVALLVSNLINHSDALLYNVQLSVTVQARDYALIISTGVLAGLCGPLLLT
LMNACHRGFVSLKLAPPWQLALGGLIVGLLSLFTPAVWGNGYSTVQSFLTAPPLLMIIAG
IFLCKLCAVLASSGSGAPGGVFTPTLFIGLAIGMLYGRSLGLWFPDGEEITLLLGLTGMA
TLLAATTHAPIMSTLMICEMTGEYQLLPGLLIACVIASVISRTLHRDSIYRQHTAQHS