Protein Info for b1584 in Escherichia coli BW25113

Name: speG
Annotation: spermidine N1-acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF13302: Acetyltransf_3" amino acids 8 to 140 (133 residues), 78.6 bits, see alignment E=2.8e-25 PF13523: Acetyltransf_8" amino acids 15 to 146 (132 residues), 30.8 bits, see alignment E=7e-11 PF00583: Acetyltransf_1" amino acids 33 to 140 (108 residues), 70.9 bits, see alignment E=4e-23 PF13673: Acetyltransf_10" amino acids 46 to 145 (100 residues), 27.9 bits, see alignment E=7.1e-10 PF13508: Acetyltransf_7" amino acids 58 to 141 (84 residues), 37.8 bits, see alignment E=7.2e-13 PF08445: FR47" amino acids 87 to 142 (56 residues), 22.9 bits, see alignment E=2.4e-08

Best Hits

Swiss-Prot: 100% identical to ATDA_ECOLI: Spermidine N(1)-acetyltransferase (speG) from Escherichia coli (strain K12)

KEGG orthology group: K00657, diamine N-acetyltransferase [EC: 2.3.1.57] (inferred from 100% identity to eco:b1584)

MetaCyc: 100% identical to spermidine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Diamine N-acetyltransferase. [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]

Predicted SEED Role

"Spermidine N1-acetyltransferase (EC 2.3.1.57)" in subsystem Polyamine Metabolism (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A951 at UniProt or InterPro

Protein Sequence (186 amino acids)

>b1584 spermidine N1-acetyltransferase (NCBI) (Escherichia coli BW25113)
MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRF
VVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKL
YLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQHQYLAEHKTPGQTL
LKPTAQ