Protein Info for b1563 in Escherichia coli BW25113

Name: relE
Annotation: Qin prophage; toxin of the RelE-RelB toxin-antitoxin system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 TIGR02385: addiction module toxin, RelE/StbE family" amino acids 5 to 86 (82 residues), 54.6 bits, see alignment E=6.3e-19 PF05016: ParE_toxin" amino acids 6 to 83 (78 residues), 50.8 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 100% identical to RELE_ECOLI: mRNA interferase toxin RelE (relE) from Escherichia coli (strain K12)

KEGG orthology group: K06218, RelE protein (inferred from 100% identity to eco:b1563)

MetaCyc: 100% identical to Qin prophage; mRNA interferase toxin RelE (Escherichia coli K-12 substr. MG1655)
3.1.26.-

Predicted SEED Role

"RelE/StbE replicon stabilization toxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0C077 at UniProt or InterPro

Protein Sequence (95 amino acids)

>b1563 Qin prophage; toxin of the RelE-RelB toxin-antitoxin system (NCBI) (Escherichia coli BW25113)
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGY
RLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL