Protein Info for b1547 in Escherichia coli BW25113

Name: stfQ
Annotation: Qin prophage; predicted side tail fibre assembly protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF07484: Collar" amino acids 94 to 141 (48 residues), 43.9 bits, see alignment 1.9e-15 PF03335: Phage_fiber" amino acids 157 to 170 (14 residues), 13.3 bits, see alignment (E = 8e-06) amino acids 189 to 202 (14 residues), 15.7 bits, see alignment (E = 1.3e-06) amino acids 255 to 268 (14 residues), 14.2 bits, see alignment (E = 4.1e-06) amino acids 270 to 281 (12 residues), 11.7 bits, see alignment (E = 2.5e-05) amino acids 279 to 290 (12 residues), 11 bits, see alignment (E = 4.2e-05)

Best Hits

Swiss-Prot: 100% identical to STFQ_ECOLI: Prophage side tail fiber protein homolog StfQ (stfQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1547)

Predicted SEED Role

"Phage tail fiber protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77515 at UniProt or InterPro

Protein Sequence (320 amino acids)

>b1547 Qin prophage; predicted side tail fibre assembly protein (NCBI) (Escherichia coli BW25113)
MNITALTDNTQGAAGLELYEVYNNGYPTAYGNIIHLKGMTAVGEGELLIGWSGTSGAHAP
AFIRSRRDTTDANWSPWAQLYTSAHPPAEFYPVGAPIPWPSDTVPSGYALMQGQTFDKSA
YPKLAVAYPSGVIPDMRGWTIKGKPASGRAVLSQEQDGIKSHTHSASASSTDLGTETTSS
FDYGTKSTNNTGAHTHSISGTANSAGAHQHKSSGAFGGTNTSIFPNGYTAISNLSAGIMS
TTSGSGQTRNAGKTSSDGAHTHSLSGTAASAGAHAHTVGIGAHTHSVAIGSHGHTITVNA
AGNAENTVKNIAFNYIVRLA