Protein Info for b1522 in Escherichia coli BW25113

Name: yneF
Annotation: predicted diguanylate cyclase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details PF00990: GGDEF" amino acids 146 to 304 (159 residues), 138.2 bits, see alignment E=1.1e-44 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 146 to 306 (161 residues), 130 bits, see alignment E=3.5e-42

Best Hits

Swiss-Prot: 100% identical to DGCF_ECOLI: Probable diguanylate cyclase DgcF (dgcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1522)

Predicted SEED Role

"FIG00638480: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76147 at UniProt or InterPro

Protein Sequence (315 amino acids)

>b1522 predicted diguanylate cyclase (NCBI) (Escherichia coli BW25113)
MLADWFSEQFSTGVLIVPCMLTLAIPGVLPRFKAEQMMPAIALIVSVIASVVIGGAGSLA
FPLPALIWCAVRYTPQVTCLLTFVTGAVEIVLVANSVIDISVGSPFSIPQMFSARLGIAT
MAICPIMVSFSVAAINSLMKQVALRADFDFLTQVYSRSGLYEALKSPSLKQTQHLTVMLL
DIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGGEEFAVAVPSVNPVDGLL
MAEKIRKGVELQPFTWQQKTLYLTVSIGVGSGRASYLTLTDDFNKLMVEADTCLYRSKKD
GRNRTSTMRYGEEVV