Protein Info for b1516 in Escherichia coli BW25113

Name: lsrB
Annotation: AI2 transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 30 to 285 (256 residues), 211.8 bits, see alignment E=6.7e-67

Best Hits

Swiss-Prot: 100% identical to LSRB_ECODH: Autoinducer 2-binding protein LsrB (lsrB) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K10555, AI-2 transport system substrate-binding protein (inferred from 100% identity to eco:b1516)

MetaCyc: 100% identical to Autoinducer-2 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, periplasmic AI-2 binding protein LsrB" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76142 at UniProt or InterPro

Protein Sequence (340 amino acids)

>b1516 AI2 transporter (NCBI) (Escherichia coli BW25113)
MTLHRFKKIALLSALGIAAISMNVQAAERIAFIPKLVGVGFFTSGGNGAQQAGKELGVDV
TYDGPTEPSVSGQVQLINNFVNQGYNAIIVSAVSPDGLCPALKRAMQRGVRVLTWDSDTK
PECRSYYINQGTPAQLGGMLVDMAARQVNKDKAKVAFFYSSPTVTDQNQWVKEAKAKIAK
EHPGWEIVTTQFGYNDATKSLQTAEGILKAYSDLDAIIAPDANALPAAAQAAENLKNDKV
AIVGFSTPNVMRPYVERGTVKEFGLWDVVQQGKISVYVADALLKKGSMKTGDKLDIKGVG
QVEVSPNSVQGYDYEADGNGIVLLPERVIFNKENIGKYDF