Protein Info for b1515 in Escherichia coli BW25113

Name: lsrD
Annotation: AI2 transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 5 to 8 (4 residues), see Phobius details transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 33 to 56 (24 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 305 (271 residues), 166.5 bits, see alignment E=3.4e-53

Best Hits

Swiss-Prot: 100% identical to LSRD_ECOLC: Autoinducer 2 import system permease protein LsrD (lsrD) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K10557, AI-2 transport system permease protein (inferred from 100% identity to eco:b1515)

MetaCyc: 100% identical to Autoinducer-2 ABC transporter membrane subunit LsrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, membrane channel protein LsrD" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFS1 at UniProt or InterPro

Protein Sequence (330 amino acids)

>b1515 AI2 transporter (NCBI) (Escherichia coli BW25113)
MRIRYGWELALAALLVIEIVAFGAINPRMLDLNMLLFSTSDFICIGIVALPLTMVIVSGG
IDISFGSTIGLCAIALGVLFQSGVPMPLAILLTLLLGALCGLINAGLIIYTKVNPLVITL
GTLYLFAGSALLLSGMAGATGYEGIGGFPMAFTDFANLDVLGLPVPLIIFLICLLVFWLW
LHKTHAGRNVFLIGQSPRVALYSAIPVNRTLCALYAMTGLASAVAAVLLVSYFGSARSDL
GASFLMPAITAVVLGGANIYGGSGSIIGTAIAVLLVGYLQQGLQMAGVPNQVSSALSGAL
LIVVVVGRSVSLHRQQIKEWLARRANNPLP