Protein Info for b1513 in Escherichia coli BW25113

Name: lsrA
Annotation: fused AI2 transporter subunits of ABC superfamily: ATP-binding components (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00005: ABC_tran" amino acids 27 to 169 (143 residues), 99.3 bits, see alignment E=3e-32 amino acids 280 to 431 (152 residues), 80 bits, see alignment E=2.8e-26

Best Hits

Swiss-Prot: 100% identical to LSRA_ECODH: Autoinducer 2 import ATP-binding protein LsrA (lsrA) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K10558, AI-2 transport system ATP-binding protein (inferred from 100% identity to eco:b1513)

MetaCyc: 100% identical to Autoinducer-2 ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, fused AI2 transporter subunits and ATP-binding component" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77257 at UniProt or InterPro

Protein Sequence (511 amino acids)

>b1513 fused AI2 transporter subunits of ABC superfamily: ATP-binding components (NCBI) (Escherichia coli BW25113)
MQTSDTRALPLLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGI
TPADSGTLEIEGNNYVRLTPVHAHQLGIYLVPQEPLLFPSLSIKENILFGLAKKQLSMQK
MKNLLAALGCQFDLHSLAGSLDVADRQMVEILRGLMRDSRILILDEPTASLTPAETERLF
SRLQELLATGVGIVFISHKLPEIRQIADRISVMRDGTIALSGKTSELSTDDIIQAITPAV
REKSLSASQKLWLELPGNRPQHAAGTPVLTLENLTGEGFRNVSLTLNAGEILGLAGLVGA
GRTELAETLYGLRTLRGGRIMLNGKEINKLSTGERLLRGLVYLPEDRQSSGLNLDASLAW
NVCALTHNLRGFWAKTAKDNATLERYRRALNIKFNQPEQAARTLSGGNQQKILIAKCLEA
SPQVLIVDEPTRGVDVSARNDIYQLLRSIAAQNVAVLLISSDLEEIELMADRVYVMHQGE
ITHSALTERDINVETIMRVAFGDSQRQEASC