Protein Info for b1502 in Escherichia coli BW25113

Name: ydeQ
Annotation: predicted fimbrial-like adhesin protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF09160: FimH_man-bind" amino acids 27 to 171 (145 residues), 259.1 bits, see alignment E=9.5e-82

Best Hits

Swiss-Prot: 100% identical to YDEQ_ECOLI: Uncharacterized fimbrial-like protein YdeQ (ydeQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1502)

Predicted SEED Role

"mannose-specific adhesin FimH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77588 at UniProt or InterPro

Protein Sequence (304 amino acids)

>b1502 predicted fimbrial-like adhesin protein (NCBI) (Escherichia coli BW25113)
MGKTISIKVLFGIYLLLMAGKVFAFSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDL
SQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGD
KTPMPLPLKLYITPVGAAGGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNNVVM
PTGGCTVDSRNVTVDLPDFPGSAEIPLGVYCSSEQKLSFYLSGATTDSSRQVFANTAPDA
TKASGVGVTLMRNGKILATGENVSLGTVNKSKVPLGLSATYGQTGNKVSAGTVQSVIGVT
FIYE